PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G1340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 268aa    MW: 30424.7 Da    PI: 5.1979
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G1340genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.7e-182471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  l+ +v+ +G g+W+++ar  g++Rt+k+c++rw++yl
      Gh_D08G1340 24 KGPWTEEEDYMLKTYVNVHGEGSWNSVARLSGLKRTGKSCRLRWLNYL 71
                     79********************************************97 PP

2Myb_DNA-binding506.7e-1677120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ + +E++l+++++ q+G++ W++Ia++++ gRt++++k++w++
      Gh_D08G1340  77 RGNISLQEQLLILQLHSQWGNR-WSKIAQHLP-GRTDNEIKNYWRT 120
                      788899****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-211774IPR009057Homeodomain-like
PROSITE profilePS5129424.8531975IPR017930Myb domain
SuperFamilySSF466893.56E-3121118IPR009057Homeodomain-like
SMARTSM007171.6E-152373IPR001005SANT/Myb domain
PfamPF002498.7E-172471IPR001005SANT/Myb domain
CDDcd001671.09E-112671No hitNo description
Gene3DG3DSA:1.10.10.607.2E-2275125IPR009057Homeodomain-like
SMARTSM007173.4E-1476124IPR001005SANT/Myb domain
PROSITE profilePS5129418.81376126IPR017930Myb domain
PfamPF002492.4E-1477120IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MDVYESGFIS EMTPQSKEDM DVRKGPWTEE EDYMLKTYVN VHGEGSWNSV ARLSGLKRTG  60
KSCRLRWLNY LRPEVRRGNI SLQEQLLILQ LHSQWGNRWS KIAQHLPGRT DNEIKNYWRT  120
RVQKQAKQLK CDVNSKQFRD AMRYVWIPRL VEQICSSSGS HSAQQSSSTT TTYADTIGSV  180
RVDPRLLPEL SGTSSDSLDA QVSSVSDLTN SKYPNSLQNG SGSGNTIAGT WGGVEIEATD  240
GGDSMESVWN EEDIWFLRQQ LYDDDDLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24211264108B-MYB
1h8a_C4e-242112624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.156570.0boll| ovule| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475004.11e-175PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE17e-71MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D2R4U61e-175A0A0D2R4U6_G
STRINGPOPTR_0014s11230.19e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.12e-73myb domain protein 2